PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.3107s0001.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 401aa    MW: 44662.5 Da    PI: 4.4767
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.3107s0001.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.6e-33234288155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k r+rWtpeLHe Fv+av+qLGGs+kAtPk +l++mkv+gLt++hvkSHLQkYR 
  Araha.3107s0001.2.p 234 KGRMRWTPELHEVFVDAVNQLGGSNKATPKGVLKHMKVQGLTIYHVKSHLQKYRQ 288
                          56****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.778231291IPR017930Myb domain
SuperFamilySSF466896.45E-18233288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-30233289IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-24234289IPR006447Myb domain, plants
PfamPF002493.6E-10236287IPR001005SANT/Myb domain
PfamPF143795.3E-20320364IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MIPNDDDDDA NRPLRSIPND DDDDDDANCP LRSIPNDDEL SHNFSLIPSL PNPSEAAEMS  60
SNSEHHQLMA NPYHLLSENG GAVGHIYSSD LRNPFVEPGF NIASPTSFVP ETSDWIPSPL  120
PDIFDFPSGS PIQIMDDGVI DEIHKQSDLP VWDDHLITGE DSLMSAVLED LLLDTNFNSS  180
ASKVQQLNTQ SQIQQPQVVL PQPSPCVELR PLVRTVSSNS NNSNNSNNAA AAAKGRMRWT  240
PELHEVFVDA VNQLGGSNKA TPKGVLKHMK VQGLTIYHVK SHLQKYRQAK YIPEPSEGQP  300
ETKLTPLEQI TSDDTRRGID VTEALRIQME LQKKLHEQLE IQRTMQLRIE EQGKALLMMF  360
EKQNMGFGKP EQEDRTSAKT PENGSEDSDS PRPKRPRNEE *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00111ampDAPTransfer from AT2G20400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1183130.0AK118313.1 Arabidopsis thaliana At2g20400 mRNA for unknown protein, complete cds, clone: RAFL19-59-J02.
GenBankBT0061190.0BT006119.1 Arabidopsis thaliana clone U50843 unknown protein (At2g20400) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884199.10.0hypothetical protein ARALYDRAFT_900392
SwissprotQ8GUN51e-60PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLD7L3M90.0D7L3M9_ARALL; Putative uncharacterized protein
STRINGscaffold_304362.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20400.11e-178G2-like family protein